PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005249m
Common NameCARUB_v10005249mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 324aa    MW: 36047.4 Da    PI: 7.0088
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005249mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1084.6e-34175232259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+
  Carubv10005249m 175 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQRCNVKKRVERSFQDPTVVITTYEGQHNHP 232
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381306.6E-1131323IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.3E-35159234IPR003657WRKY domain
SuperFamilySSF1182901.28E-29166234IPR003657WRKY domain
PROSITE profilePS5081132.856169234IPR003657WRKY domain
SMARTSM007741.8E-39174233IPR003657WRKY domain
PfamPF031062.4E-26175232IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSNETRDLYN YQYPPSFSLH EMMNLPTSNL PSYGNIISSQ NNGFDPSSNY SFTDCLQSSP  60
AAYESILQKT FGLSPSSSEV FNSSIDQESN RDVTNDVING SGACNETTTR VSASSSSSEA  120
DHPGEDSGKS NRKRELVGEE DQSSKKVGKT KKNELKKQRE PRVSFMTKSE VDHLEDGYRW  180
RKYGQKAVKN SPYPRSYYRC TTQRCNVKKR VERSFQDPTV VITTYEGQHN HPIPTNLRGS  240
SAAAAMFSAD LMTPRSFAHD MFRTAAYASG GPAGAALDYG YGQNGYGNVN ANPSSHQDQY  300
HHGGDQYELL REIFPSMFFK QEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-29165234877Probable WRKY transcription factor 4
2lex_A2e-29165234877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4423930.0AF442393.1 Arabidopsis thaliana WRKY transcription factor 28 (WRKY28) mRNA, complete cds.
GenBankAY0707610.0AY070761.1 Arabidopsis thaliana AT4g18170/T9A21_10 mRNA, complete cds.
GenBankAY1169430.0AY116943.1 Arabidopsis thaliana AT4g18170/T9A21_10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284116.10.0hypothetical protein CARUB_v10005249mg
SwissprotQ8VWJ20.0WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLR0GJI00.0R0GJI0_9BRAS; Uncharacterized protein
STRINGAT4G18170.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-179WRKY DNA-binding protein 28